PDB entry 1icw

View 1icw on RCSB PDB site
Description: interleukin-8, mutant with glu 38 replaced by cys and cys 50 replaced by ala
Deposited on 1996-09-18, released 1997-03-12
The last revision prior to the SCOP 1.57 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.194
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1icwa_
  • Chain 'B':
    Domains in SCOP 1.57: d1icwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1icwA (A:)
    elrcqciktyskpfhpkfikelrviesgphcantciivklsdgrelaldpkenwvqrvve
    kflkraens
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1icwB (B:)
    cqciktyskpfhpkfikelrviesgphcantciivklsdgrelaldpkenwvqrvvekfl
    kraens