PDB entry 1ici

View 1ici on RCSB PDB site
Description: crystal structure of a sir2 homolog-nad complex
Class: transcription
Keywords: Rossmann fold, Zinc ribbon, protein deacetylase, NAD-binding, TRANSCRIPTION
Deposited on 2001-04-01, released 2001-05-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.199
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulatory protein, Sir2 family
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF1676
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28597 (11-255)
      • expression tag (0-10)
    Domains in SCOPe 2.06: d1icia1, d1icia2
  • Chain 'B':
    Compound: Transcriptional regulatory protein, Sir2 family
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF1676
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1icib_
  • Heterogens: ZN, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iciA (A:)
    gshhhhhhgshmdekllktiaeskylvaltgagvsaesgiptfrgkdglwnryrpeelan
    pqafakdpekvwkwyawrmekvfnaqpnkahqafaelerlgvlkclitqnvddlherags
    rnvihlhgslrvvrctscnnsfevesapkipplpkcdkcgsllrpgvvwfgemlppdvld
    ramreveradviivagtsavvqpaaslplivkqrggaiieinpdetpltpiadyslrgka
    gevmdelvrhvrkals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iciB (B:)
    gshhhhhhgshmdekllktiaeskylvaltgagvsaesgiptfrgkdglwnryrpeelan
    pqafakdpekvwkwyawrmekvfnaqpnkahqafaelerlgvlkclitqnvddlherags
    rnvihlhgslrvvrctscnnsfevesapkipplpkcdkcgsllrpgvvwfgemlppdvld
    ramreveradviivagtsavvqpaaslplivkqrggaiieinpdetpltpiadyslrgka
    gevmdelvrhvrkals
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iciB (B:)
    dekllktiaeskylvaltgagvsaesgiptfrgkdglwnryrpeelanpqafakdpekvw
    kwyawrmekvfnaqpnkahqafaelerlgvlkclitqnvddlheragsrnvihlhgslrv
    vrctscnnsfevesapkipplpkcdkcgsllrpgvvwfgemlppdvldramreveradvi
    ivagtsavvqpaaslplivkqrggaiieinpdetpltpiadyslrgkagevmdelvrhvr
    kals