PDB entry 1ich

View 1ich on RCSB PDB site
Description: solution structure of the tumor necrosis factor receptor-1 death domain
Class: apoptosis
Keywords: death domain, APOPTOSIS
Deposited on 2001-04-01, released 2002-04-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor receptor-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19438
      • engineered (32)
    Domains in SCOPe 2.04: d1icha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ichA (A:)
mahkpqsldtddpatlyavvenvpplrwkefvkrlglsdheidrlelqngrclreaqysm
latwrrrtprreatlellgrvlrdmdllgcledieealcgpaalppapsllr

    Sequence, based on observed residues (ATOM records): (download) 
    >1ichA (A:)
patlyavvenvpplrwkefvkrlglsdheidrlelqngrclreaqysmlatwrrrtprre
atlellgrvlrdmdllgcledieealc