PDB entry 1ic1

View 1ic1 on RCSB PDB site
Description:
Deposited on 1998-03-09, released 1998-06-17
The last revision prior to the SCOP 1.57 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.222
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1ic1a1, d1ic1a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1ic1b1, d1ic1b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ic1A (A:)
    qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
    sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgknltlrcqveggapranlt
    vvllrgekelkrepavgepaevtttvlvrrdhhganfscrteldlrpqglelfentsapy
    qlqtfvlpat
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ic1B (B:)
    qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
    sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgknltlrcqveggapranlt
    vvllrgekelkrepavgepaevtttvlvrrdhhganfscrteldlrpqglelfentsapy
    qlqtfvlpat