PDB entry 1ic0

View 1ic0 on RCSB PDB site
Description: red copper protein nitrosocyanin from nitrosomonas europaea
Deposited on 2001-03-29, released 2001-06-06
The last revision prior to the SCOP 1.59 freeze date was dated 2001-06-06, with a file datestamp of 2001-06-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.215
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1ic0a_
  • Chain 'B':
    Domains in SCOP 1.59: d1ic0b_
  • Chain 'C':
    Domains in SCOP 1.59: d1ic0c_
  • Chain 'D':
    Domains in SCOP 1.59: d1ic0d_
  • Chain 'E':
    Domains in SCOP 1.59: d1ic0e_
  • Chain 'F':
    Domains in SCOP 1.59: d1ic0f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ic0A (A:)
    hnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspiseg
    fsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ic0B (B:)
    hnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspiseg
    fsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ic0C (C:)
    hnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspiseg
    fsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ic0D (D:)
    hnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspiseg
    fsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ic0E (E:)
    hnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspiseg
    fsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ic0F (F:)
    nfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspisegf
    sidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve