PDB entry 1ibz

View 1ibz on RCSB PDB site
Description: red copper protein nitrosocyanin from nitrosomonas europaea
Deposited on 2001-03-29, released 2001-06-06
The last revision prior to the SCOP 1.61 freeze date was dated 2001-06-06, with a file datestamp of 2001-06-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.179
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1ibza_
  • Chain 'B':
    Domains in SCOP 1.61: d1ibzb_
  • Chain 'C':
    Domains in SCOP 1.61: d1ibzc_
  • Chain 'D':
    Domains in SCOP 1.61: d1ibzd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibzA (A:)
    hnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspiseg
    fsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibzB (B:)
    ehnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspise
    gfsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibzC (C:)
    nfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspisegf
    sidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibzD (D:)
    ehnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspise
    gfsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve