PDB entry 1ibz

View 1ibz on RCSB PDB site
Description: red copper protein nitrosocyanin from nitrosomonas europaea
Class: metal binding protein
Keywords: red copper, cupredoxin, beta hairpin, nitrosocyanin, Nitrosomonas europaea, METAL BINDING PROTEIN
Deposited on 2001-03-29, released 2001-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrosocyanin
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ibza_
  • Chain 'B':
    Compound: nitrosocyanin
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ibzb_
  • Chain 'C':
    Compound: nitrosocyanin
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ibzc_
  • Chain 'D':
    Compound: nitrosocyanin
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ibzd_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ibzA (A:)
    ehnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspise
    gfsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ibzA (A:)
    hnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspiseg
    fsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibzB (B:)
    ehnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspise
    gfsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ibzC (C:)
    ehnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspise
    gfsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ibzC (C:)
    nfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspisegf
    sidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibzD (D:)
    ehnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspise
    gfsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve