PDB entry 1iby

View 1iby on RCSB PDB site
Description: red copper protein nitrosocyanin from nitrosomonas europaea
Deposited on 2001-03-29, released 2001-06-06
The last revision prior to the SCOP 1.61 freeze date was dated 2001-06-06, with a file datestamp of 2001-06-06.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.186
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1ibya_
  • Chain 'B':
    Domains in SCOP 1.61: d1ibyb_
  • Chain 'C':
    Domains in SCOP 1.61: d1ibyc_
  • Chain 'D':
    Domains in SCOP 1.61: d1ibyd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibyA (A:)
    ehnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspise
    gfsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibyB (B:)
    ehnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspise
    gfsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibyC (C:)
    ehnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspise
    gfsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibyD (D:)
    ehnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspise
    gfsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve