PDB entry 1iby

View 1iby on RCSB PDB site
Description: red copper protein nitrosocyanin from nitrosomonas europaea
Class: metal binding protein
Keywords: red copper, cupredoxin, beta hairpin, nitrosocyanin, nitrosomonas europaea, METAL BINDING PROTEIN
Deposited on 2001-03-29, released 2001-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrosocyanin
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ibya_
  • Chain 'B':
    Compound: nitrosocyanin
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ibyb_
  • Chain 'C':
    Compound: nitrosocyanin
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ibyc_
  • Chain 'D':
    Compound: nitrosocyanin
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ibyd_
  • Heterogens: CU, HEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ibyA (A:)
ehnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspise
gfsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ibyB (B:)
ehnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspise
gfsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ibyC (C:)
ehnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspise
gfsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ibyD (D:)
ehnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspise
gfsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve