PDB entry 1ibr

View 1ibr on RCSB PDB site
Description: complex of ran with importin beta
Deposited on 1999-05-14, released 1999-06-03
The last revision prior to the SCOP 1.59 freeze date was dated 2001-07-11, with a file datestamp of 2001-07-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.245
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1ibra_
  • Chain 'B':
    Domains in SCOP 1.59: d1ibrb_
  • Chain 'C':
    Domains in SCOP 1.59: d1ibrc_
  • Chain 'D':
    Domains in SCOP 1.59: d1ibrd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibrA (A:)
    vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
    qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
    rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibrB (B:)
    elitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglqi
    knsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacaei
    pvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqgm
    rkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqnl
    vkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieaseaa
    eqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcced
    divphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdps
    vvvrdtaawtvgricellpeaaindvylapllqclieg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibrC (C:)
    vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
    qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
    rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibrD (D:)
    elitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglqi
    knsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacaei
    pvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqgm
    rkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqnl
    vkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieaseaa
    eqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcced
    divphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdps
    vvvrdtaawtvgricell