PDB entry 1ibq

View 1ibq on RCSB PDB site
Description: aspergillopepsin from aspergillus phoenicis
Class: hydrolase
Keywords: aspergillopepsin, aspartic proteinase, hydrolase
Deposited on 2001-03-28, released 2001-07-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.221
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspergillopepsin
    Species: Aspergillus phoenicis [TaxId:5063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ibqa_
  • Chain 'B':
    Compound: aspergillopepsin
    Species: Aspergillus phoenicis [TaxId:5063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ibqb_
  • Heterogens: MAN, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibqA (A:)
    skgsavttpqnndeeyltpvtvgkstlhldfdtgsadlwvfsdelpsseqtghdlytpss
    satklsgyswdisygdgssasgdvyrdtvtvggvttnkqaveaaskissefvqdtandgl
    lglafssintvqpkaqttffdtvksqldsplfavqlkhdapgvydfgyiddskytgsity
    tdadssqgywgfstdgysigdgsssssgfsaiadtgttlillddeivsayyeqvsgaqes
    yeaggyvfscstdlpdftvvigdykavvpgkyinyapvstgsstcyggiqsnsglglsil
    gdvflksqyvvfnsegpklgfaaqa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibqB (B:)
    skgsavttpqnndeeyltpvtvgkstlhldfdtgsadlwvfsdelpsseqtghdlytpss
    satklsgyswdisygdgssasgdvyrdtvtvggvttnkqaveaaskissefvqdtandgl
    lglafssintvqpkaqttffdtvksqldsplfavqlkhdapgvydfgyiddskytgsity
    tdadssqgywgfstdgysigdgsssssgfsaiadtgttlillddeivsayyeqvsgaqes
    yeaggyvfscstdlpdftvvigdykavvpgkyinyapvstgsstcyggiqsnsglglsil
    gdvflksqyvvfnsegpklgfaaqa