PDB entry 1ibi

View 1ibi on RCSB PDB site
Description: quail cysteine and glycine-rich protein, nmr, 15 minimized model structures
Class: metal binding protein
Keywords: lim domain containing proteins, metal-binding protein, metal binding protein
Deposited on 2001-03-28, released 2001-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine-rich protein 2
    Species: Coturnix japonica [TaxId:93934]
    Gene: CSRP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ibia1, d1ibia2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ibiA (A:)
mdrgerlgikpesspsphrpttnpntskfaqkfggaekcsrcgdsvyaaekvigagkpwh
kncfrcakcgkslesttltekegeiyckgcyaknfgpkgfgygqgagalvhaq

    Sequence, based on observed residues (ATOM records): (download) 
    >1ibiA (A:)
aekcsrcgdsvyaaekvigagkpwhkncfrcakcgkslesttltekegeiyckgcyakn