PDB entry 1ibh

View 1ibh on RCSB PDB site
Description: x-ray 3d structure of p.leiognathi cu,zn sod mutant m41i
Class: oxidoreductase
Keywords: prokaryotic superoxide dismutase, subunit interaction, OXIDOREDUCTASE
Deposited on 2001-03-28, released 2001-05-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.229
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cu,zn superoxide dismutase
    Species: Photobacterium leiognathi [TaxId:658]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00446 (0-150)
      • conflict (30)
      • engineered (40)
    Domains in SCOPe 2.06: d1ibha_
  • Heterogens: ZN, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibhA (A:)
    qdltvkmtdlqtgkpvgtielsqnkygvvfipeladltpgihgfhihqngscassekdgk
    vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh
    aimihaggdnhsdmpkalggggarvacgviq