PDB entry 1ibg

View 1ibg on RCSB PDB site
Description: structure and specificity of the anti-digoxin antibody 40-50
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1994-10-25, released 1995-05-08
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.209
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2b-kappa 40-50 fab (heavy chain)
    Domains in SCOP 1.75: d1ibgh1, d1ibgh2
  • Chain 'L':
    Compound: igg2b-kappa 40-50 fab (light chain)
    Database cross-references and differences (RAF-indexed):
    • PIR JC5810 (0-216)
      • conflict (25)
      • conflict (33-35)
      • conflict (51)
      • conflict (55)
      • conflict (85)
      • conflict (96)
      • conflict (105)
    Domains in SCOP 1.75: d1ibgl1, d1ibgl2
  • Heterogens: CU, OBN, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibgH (H:)
    vhlvqsgpglvapsqslsitctvsgfslttygvhwfrqppgkglewlgliwaggntdyns
    almsrlsinkdnsksqvflkmnslqaddtamyycarfrfasyydyavdywgqgtsvtvss
    akttppsvyplapgcgdttgssvtsgclvkgyfpepvtvtwnsgslsssvhtfpallqsg
    lytmsssvtvpsstwpsqtvtcsvahpassttvdkkl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibgL (L:)
    ivltqspaslavslgqratiscrasksvstsgyshihwyqqkpgqppklliylasilesg
    vparfsgsgsgtdftlnihpveeedaatyycqhsreypltfgagtelelkradaaptvsi
    fppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmss
    tltltkdeyerhnsytceathktstspivksfnrnec