PDB entry 1ibg

View 1ibg on RCSB PDB site
Description:
Deposited on 1994-10-25, released 1995-05-08
The last revision prior to the SCOP 1.65 freeze date was dated 1995-05-08, with a file datestamp of 1995-05-09.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.209
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1ibgh1, d1ibgh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1ibgl1, d1ibgl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibgH (H:)
    vhlvqsgpglvapsqslsitctvsgfslttygvhwfrqppgkglewlgliwaggntdyns
    almsrlsinkdnsksqvflkmnslqaddtamyycarfrfasyydyavdywgqgtsvtvss
    akttppsvyplapgcgdttgssvtsgclvkgyfpepvtvtwnsgslsssvhtfpallqsg
    lytmsssvtvpsstwpsqtvtcsvahpassttvdkkl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibgL (L:)
    ivltqspaslavslgqratiscrasksvstsgyshihwyqqkpgqppklliylasilesg
    vparfsgsgsgtdftlnihpveeedaatyycqhsreypltfgagtelelkradaaptvsi
    fppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmss
    tltltkdeyerhnsytceathktstspivksfnrnec