PDB entry 1ibf

View 1ibf on RCSB PDB site
Description: x-ray 3d structure of p.leiognathi cu,zn sod mutant v29g
Deposited on 2001-03-28, released 2001-05-09
The last revision prior to the SCOP 1.67 freeze date was dated 2001-05-09, with a file datestamp of 2001-05-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.223
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ibfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibfA (A:)
    qdltvkmtdlqtgkpvgtielsqnkygvgfipeladltpgmhgfhihqngscassekdgk
    vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh
    aimihaggdnhsdmpkalggggarvacgviq