PDB entry 1ibe

View 1ibe on RCSB PDB site
Description: deoxy-haemoglobin trapped in the high-affinity (r) state
Deposited on 1996-09-25, released 1996-12-23
The last revision prior to the SCOP 1.63 freeze date was dated 1996-12-23, with a file datestamp of 1996-12-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1786
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1ibea_
  • Chain 'B':
    Domains in SCOP 1.63: d1ibeb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibeA (A:)
    vlsaadktnvkaawskvgghagefgaealermflgfpttktyfphfdlshgsaqvkahgk
    kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
    vhasldkflssvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibeB (B:)
    vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
    kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
    dftpelqasyqkvvagvanalahkyh