PDB entry 1ibe

View 1ibe on RCSB PDB site
Description: deoxy-haemoglobin trapped in the high-affinity (r) state
Class: oxygen transport
Keywords: heme, oxygen transport, respiratory protein, erythrocyte
Deposited on 1996-09-25, released 1996-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin (deoxy)
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01958 (0-140)
      • variant (23)
      • conflict (81)
      • conflict (84)
    Domains in SCOPe 2.08: d1ibea_
  • Chain 'B':
    Compound: hemoglobin (deoxy)
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ibeb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibeA (A:)
    vlsaadktnvkaawskvgghagefgaealermflgfpttktyfphfdlshgsaqvkahgk
    kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
    vhasldkflssvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ibeB (B:)
    vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
    kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
    dftpelqasyqkvvagvanalahkyh