PDB entry 1ibd

View 1ibd on RCSB PDB site
Description: x-ray 3d structure of p.leiognathi cu,zn sod mutant v29a
Class: oxidoreductase
Keywords: prokaryotic superoxide dismutase, subunit interaction, OXIDOREDUCTASE
Deposited on 2001-03-28, released 2001-05-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cu,zn superoxide dismutase
  Species: Photobacterium leiognathi [TaxId:658]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00446 (0-150)
    • engineered (28)
    • conflict (30)
  Domains in SCOPe 2.08: d1ibda_
• Heterogens: ZN, CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ibdA (A:)
  qdltvkmtdlqtgkpvgtielsqnkygvafipeladltpgmhgfhihqngscassekdgk
  vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh
  aimihaggdnhsdmpkalggggarvacgviq