PDB entry 1ib8

View 1ib8 on RCSB PDB site
Description: solution structure and function of a conserved protein sp14.3 encoded by an essential streptococcus pneumoniae gene
Class: nucleic acid binding protein
Keywords: nucleic acid binding protein, ribosomal protein, essential gene, structural genomics
Deposited on 2001-03-27, released 2002-03-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved protein sp14.3
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: ESSENTIAL GENE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ib8a1, d1ib8a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ib8A (A:)
gsgvdaiativelvrevvepvieapfelvdieygkigsdmilsifvdkpegitlndtadl
temispvldtikpdpfpeqyfleitspglerplktkdavagavgkyihvglyqaidkqkv
fegtllafeedeltmeymdktrkktvqipyslvskarlavklle