PDB entry 1ib5

View 1ib5 on RCSB PDB site
Description: x-ray 3d structure of p.leiognathi cu,zn sod mutant w83y
Deposited on 2001-03-27, released 2001-05-09
The last revision prior to the SCOP 1.65 freeze date was dated 2001-05-09, with a file datestamp of 2001-05-09.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.216
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ib5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib5A (A:)
    qdltvkmtdlqtgkpvgtielsqnkygvvfipeladltpgmhgfhihqngscassekdgk
    vvlggaagghydpehtnkhgfpytddnhkgdlpalfvsanglatnpvlaprltlkelkgh
    aimihaggdnhsdmpkalggggarvacgviq