PDB entry 1ib4

View 1ib4 on RCSB PDB site
Description: Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5
Class: hydrolase
Keywords: polygalacturonase, glycosylhydrolase, hydrolase
Deposited on 2001-03-27, released 2001-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polygalacturonase
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • GB AAC23565 (0-338)
    Domains in SCOPe 2.07: d1ib4a_
  • Chain 'B':
    Compound: polygalacturonase
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • GB AAC23565 (0-338)
    Domains in SCOPe 2.07: d1ib4b_
  • Heterogens: NAG, MAN, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib4A (A:)
    attctfsgsngassasksktscstivlsnvavpsgttldltklndgthvifsgettfgyk
    ewsgplisvsgsdltitgasghsingdgsrwwdgeggnggktkpkffaahsltnsvisgl
    kivnspvqvfsvagsdyltlkditidnsdgddngghntdafdigtstyvtisgatvynqd
    dcvavnsgeniyfsggycsgghglsigsvggrsdntvknvtfvdstiinsdngvriktni
    dttgsvsdvtykditltsiakygivvqqnygdtsstpttgvpitdfvldnvhgsvvssgt
    niliscgsgscsdwtwtdvsvsggktsskctnvpsgasc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib4B (B:)
    attctfsgsngassasksktscstivlsnvavpsgttldltklndgthvifsgettfgyk
    ewsgplisvsgsdltitgasghsingdgsrwwdgeggnggktkpkffaahsltnsvisgl
    kivnspvqvfsvagsdyltlkditidnsdgddngghntdafdigtstyvtisgatvynqd
    dcvavnsgeniyfsggycsgghglsigsvggrsdntvknvtfvdstiinsdngvriktni
    dttgsvsdvtykditltsiakygivvqqnygdtsstpttgvpitdfvldnvhgsvvssgt
    niliscgsgscsdwtwtdvsvsggktsskctnvpsgasc