PDB entry 1ib1

View 1ib1 on RCSB PDB site
Description: crystal structure of the 14-3-3 zeta:serotonin n-acetyltransferase complex
Deposited on 2001-03-26, released 2001-05-02
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-02, with a file datestamp of 2001-05-02.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.204
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ib1a_
  • Chain 'B':
    Domains in SCOP 1.57: d1ib1b_
  • Chain 'C':
    Domains in SCOP 1.57: d1ib1c_
  • Chain 'D':
    Domains in SCOP 1.57: d1ib1d_
  • Chain 'E':
    Domains in SCOP 1.57: d1ib1e_
  • Chain 'F':
    Domains in SCOP 1.57: d1ib1f_
  • Chain 'G':
    Domains in SCOP 1.57: d1ib1g_
  • Chain 'H':
    Domains in SCOP 1.57: d1ib1h_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib1A (A:)
    dknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswrv
    vssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm
    kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei
    lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib1B (B:)
    dknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswrv
    vssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm
    kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei
    lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlw
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib1C (C:)
    dknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswrv
    vssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm
    kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei
    lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib1D (D:)
    dknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswrv
    vssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm
    kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei
    lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlw
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib1E (E:)
    sgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlc
    pelslgwfvegrlvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgs
    vllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib1F (F:)
    sgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlc
    pelslgwfvegrlvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgs
    vllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslr
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib1G (G:)
    sgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlc
    pelslgwfvegrlvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgs
    vllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib1H (H:)
    sgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlc
    pelslgwfvegrlvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgs
    vllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslr