PDB entry 1ib0

View 1ib0 on RCSB PDB site
Description: crystal structure of rat b5r in complex with fad and nad
Class: oxygen storage/transport
Keywords: electron transfer, methemologobinemia, NADH, FAD, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2001-03-26, released 2001-12-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nadh-cytochrome b5 reductase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: DIA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20070 (6-273)
      • expression tag (2-5)
      • conflict (25)
      • conflict (88)
    Domains in SCOPe 2.06: d1ib0a1, d1ib0a2, d1ib0a3
  • Heterogens: FAD, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ib0A (A:)
    mhhhhmitlenpdikyplrlidkeilshdtrrfrfalpspqhilglpigqhiylstridg
    nlvirpytpvssdddkgfvdlvvkvyfkethpkfpaggkmsqylenmnigdtiefrgpng
    llvyqgkgkfairadkksnpvvrtvksvgmiaggtgitpmlqviravlkdpndhtvcyll
    fanqsekdillrpeleelrnehssrfklwytvdkapdawdysqgfvneemirdhlpppge
    etlilmcgpppmiqfaclpnlervghpkercftf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ib0A (A:)
    hhhmitlenpdikyplrlidkeilshdtrrfrfalpspqhilglpigqhiylstridgnl
    virpytpvssdddkgfvdlvvkvyfkethpkfpaggkmsqylenmnigdtiefrgpngll
    vyqgkgkfairadkksnpvvrtvksvgmiaggtgitpmlqviravlkdpndhtvcyllfa
    nqsekdillrpeleelrnehssrfklwytvdkapdawdysqgfvneemirdhlpppgeet
    lilmcgpppmiqfaclpnlervghpkercftf