PDB entry 1iay

View 1iay on RCSB PDB site
Description: crystal structure of acc synthase complexed with cofactor plp and inhibitor avg
Class: lyase
Keywords: protein-cofactor-inhibitor complex, V6-dependent enzyme, LYASE
Deposited on 2001-03-24, released 2001-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.215
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-aminocyclopropane-1-carboxylate synthase 2
    Species: Solanum lycopersicum [TaxId:4081]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iaya_
  • Heterogens: PLP, AVG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iayA (A:)
    ilsklatneehgenspyfdgwkaydsdpfhplknpngviqmglaenqlcldliedwikrn
    pkgsicsegiksfkaianfqdyhglpefrkaiakfmektrggrvrfdpervvmaggatga
    netiifcladpgdaflvpspyypafnrdlrwrtgvqlipihcessnnfkitskavkeaye
    naqksnikvkgliltnpsnplgttldkdtlksvlsftnqhnihlvcdeiyaatvfdtpqf
    vsiaeildeqemtycnkdlvhivyslskdmglpgfrvgiiysfnddvvncarkmssfglv
    stqtqyflaamlsdekfvdnflresamrlgkrhkhftnglevvgikclknnaglfcwmdl
    rpllrestfdsemslwrviindvklnvspgssfecqepgwfrvcfanmddgtvdialari
    rrfvgvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iayA (A:)
    ilsklatnespyfdgwkaydsdpfhplknpngviqmglaenqlcldliedwikrnpkgsi
    cssfkaianfqdyhglpefrkaiakfmektrggrvrfdpervvmaggatganetiifcla
    dpgdaflvpspyypafnrdlrwrtgvqlipihcessnnfkitskavkeayenaqksnikv
    kgliltnpsnplgttldkdtlksvlsftnqhnihlvcdeiyaatvfdtpqfvsiaeilde
    qemtycnkdlvhivyslskdmglpgfrvgiiysfnddvvncarkmssfglvstqtqyfla
    amlsdekfvdnflresamrlgkrhkhftnglevvgikclknnaglfcwmdlrpllrestf
    dsemslwrviindvklnvspgssfecqepgwfrvcfanmddgtvdialarirrfvgvek