PDB entry 1iax

View 1iax on RCSB PDB site
Description: crystal structure of acc synthase complexed with plp
Class: lyase
Keywords: plp-dependent enzymes, LYASE
Deposited on 2001-03-24, released 2001-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.218
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-aminocyclopropane-1-carboxylate synthase 2
    Species: Solanum lycopersicum [TaxId:4081]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iaxa_
  • Chain 'B':
    Compound: 1-aminocyclopropane-1-carboxylate synthase 2
    Species: Solanum lycopersicum [TaxId:4081]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iaxb_
  • Heterogens: SO4, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iaxA (A:)
    ilsklatneehgenspyfdgwkaydsdpfhplknpngviqmglaenqlcldliedwikrn
    pkgsicsegiksfkaianfqdyhglpefrkaiakfmektrggrvrfdpervvmaggatga
    netiifcladpgdaflvpspyypafnrdlrwrtgvqlipihcessnnfkitskavkeaye
    naqksnikvkgliltnpsnplgttldkdtlksvlsftnqhnihlvcdeiyaatvfdtpqf
    vsiaeildeqemtycnkdlvhivyslskdmglpgfrvgiiysfnddvvncarkmssfglv
    stqtqyflaamlsdekfvdnflresamrlgkrhkhftnglevvgikclknnaglfcwmdl
    rpllrestfdsemslwrviindvklnvspgssfecqepgwfrvcfanmddgtvdialari
    rrfvgvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iaxA (A:)
    ilsklatnespyfdgwkaydsdpfhplknpngviqmglaenqlcldliedwikrnpkgsi
    sfkaianfqdyhglpefrkaiakfmektrggrvrfdpervvmaggatganetiifcladp
    gdaflvpspyypafnrdlrwrtgvqlipihcessnnfkitskavkeayenaqksnikvkg
    liltnpsnplgttldkdtlksvlsftnqhnihlvcdeiyaatvfdtpqfvsiaeildeqe
    mtycnkdlvhivyslskdmglpgfrvgiiysfnddvvncarkmssfglvstqtqyflaam
    lsdekfvdnflresamrlgkrhkhftnglevvgikclknnaglfcwmdlrpllrestfds
    emslwrviindvklnvspgssfecqepgwfrvcfanmddgtvdialarirrfvgvek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iaxB (B:)
    ilsklatneehgenspyfdgwkaydsdpfhplknpngviqmglaenqlcldliedwikrn
    pkgsicsegiksfkaianfqdyhglpefrkaiakfmektrggrvrfdpervvmaggatga
    netiifcladpgdaflvpspyypafnrdlrwrtgvqlipihcessnnfkitskavkeaye
    naqksnikvkgliltnpsnplgttldkdtlksvlsftnqhnihlvcdeiyaatvfdtpqf
    vsiaeildeqemtycnkdlvhivyslskdmglpgfrvgiiysfnddvvncarkmssfglv
    stqtqyflaamlsdekfvdnflresamrlgkrhkhftnglevvgikclknnaglfcwmdl
    rpllrestfdsemslwrviindvklnvspgssfecqepgwfrvcfanmddgtvdialari
    rrfvgvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iaxB (B:)
    ilsklatnespyfdgwkaydsdpfhplknpngviqmglaenqlcldliedwikrnpkgsi
    sfkaianfqdyhglpefrkaiakfmektrggrvrfdpervvmaggatganetiifcladp
    gdaflvpspyypafnrdlrwrtgvqlipihcessnnfkitskavkeayenaqksnikvkg
    liltnpsnplgttldkdtlksvlsftnqhnihlvcdeiyaatvfdtpqfvsiaeildeqe
    mtycnkdlvhivyslskdmglpgfrvgiiysfnddvvncarkmssfglvstqtqyflaam
    lsdekfvdnflresamrlgkrhkhftnglevvgikclknnaglfcwmdlrpllrestfds
    emslwrviindvklnvspgssfecqepgwfrvcfanmddgtvdialarirrfvgvek