PDB entry 1iau

View 1iau on RCSB PDB site
Description: human granzyme b in complex with ac-iepd-cho
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex
Deposited on 2001-03-23, released 2001-05-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.239
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: granzyme b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10144 (0-End)
      • variant (34)
    Domains in SCOPe 2.01: d1iaua_
  • Chain 'B':
    Compound: acetyl-isoleucyl-glutamyl-prolyl-aspartyl-aldehyde peptide INHIBITOR
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1IAU (Start-3)
  • Heterogens: NAG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iauA (A:)
    iiggheakphsrpymaylmiwdqkslkrcggflirddfvltaahcwgssinvtlgahnik
    eqeptqqfipvkrpiphpaynpknfsndimllqlerkakrtravqplrlpsnkaqvkpgq
    tcsvagwgqtaplgkhshtlqevkmtvqedrkcesdlrhyydstielcvgdpeikktsfk
    gdsggplvcnkvaqgivsygrnngmppractkvssfvhwikktmkry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iauA (A:)
    iiggheakphsrpymaylmiwdqkslkrcggflirddfvltaahcwgssinvtlgahnik
    eqeptqqfipvkrpiphpaynpknfsndimllqlerkakrtravqplrlpsnkaqvkpgq
    tcsvagwgqtaplgkhshtlqevkmtvqedrkcesdlrhyydstielcvgdpeikktsfk
    gdsggplvcnkvaqgivsygrnngmppractkvssfvhwikktmkr
    

  • Chain 'B':
    No sequence available.