PDB entry 1iaq

View 1iaq on RCSB PDB site
Description: c-h-ras p21 protein mutant with thr 35 replaced by ser (t35s) complexed with guanosine-5'-[b,g-imido] triphosphate
Class: signaling protein
Keywords: GTP-binding, Proto-oncogene, SIGNALING PROTEIN
Deposited on 2001-03-23, released 2001-06-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.242
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming protein p21/h-ras-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS OR HRAS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1iaqa_
  • Chain 'B':
    Compound: transforming protein p21/h-ras-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS OR HRAS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1iaqb_
  • Chain 'C':
    Compound: transforming protein p21/h-ras-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS OR HRAS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1iaqc_
  • Heterogens: MG, GNP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iaqA (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydpsiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iaqA (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdsyrkqvvidgetclldildtagqymrtgeg
    flcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesrqaqdlarsy
    gipyietsaktrqgvedafytlvreirqh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iaqB (B:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydpsiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iaqB (B:)
    mteyklvvvgaggvgksaltiqliqnhfvsyrkqvvidgetclldildtagqrdqymrtg
    egflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesrqaqdlar
    sygipyietsaktrqgvedafytlvreirqh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1iaqC (C:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydpsiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iaqC (C:)
    mteyklvvvgaggvgksaltiqliqnhfvdedsyrkqvvidgetclldildtagqeeymr
    tgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesrqaqdl
    arsygipyietsaktrqgvedafytlvreirqh