PDB entry 1iam

View 1iam on RCSB PDB site
Description: structure of the two amino-terminal domains of human intercellular adhesion molecule-1, icam-1
Class: Viral protein receptor
Keywords: RHINOVIRUS RECEPTOR, CELL ADHESION, INTEGRIN LIGAND, GLYCOPROTEIN, LFA-1 LIGAND, IMMUNOGLOBULIN FOLD, TRANSMEMBRANE, Viral protein receptor
Deposited on 1998-02-22, released 1998-04-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.214
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intercellular adhesion molecule-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05362 (0-184)
      • engineered (102)
      • engineered (117)
      • engineered (155)
    Domains in SCOPe 2.06: d1iama1, d1iama2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iamA (A:)
    qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
    sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgkqltlrcqveggapraqlt
    vvllrgekelkrepavgepaevtttvlvrrdhhgaqfscrteldlrpqglelfentsapy
    qlqtf