PDB entry 1iam

View 1iam on RCSB PDB site
Description: structure of the two amino-terminal domains of human intercellular adhesion molecule-1, icam-1
Deposited on 1998-02-22, released 1998-04-29
The last revision prior to the SCOP 1.59 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.214
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iam_ (-)
    qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
    sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgkqltlrcqveggapraqlt
    vvllrgekelkrepavgepaevtttvlvrrdhhgaqfscrteldlrpqglelfentsapy
    qlqtf