PDB entry 1iam

View 1iam on RCSB PDB site
Description:
Deposited on 1998-02-22, released 1998-04-29
The last revision prior to the SCOP 1.57 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.214
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1iam_1, d1iam_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iam_ (-)
    qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
    sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgkqltlrcqveggapraqlt
    vvllrgekelkrepavgepaevtttvlvrrdhhgaqfscrteldlrpqglelfentsapy
    qlqtf