PDB entry 1iai

View 1iai on RCSB PDB site
Description: idiotype-anti-idiotype fab complex
Class: complex (immunoglobulin igg1/igg2a)
Keywords: complex (immunoglobulin igg1/igg2a)
Deposited on 1993-12-28, released 1996-03-08
The last revision prior to the SCOP 1.75 freeze date was dated 1996-03-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.21
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: idiotypic fab 730.1.4 (igg1) of virus neutralizing antibody
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1iaih1, d1iaih2
  • Chain 'I':
    Compound: anti-idiotypic fab 409.5.3 (igg2a)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • GB AAB34981 (0-217)
      • conflict (4)
      • conflict (19)
      • conflict (27)
      • conflict (29-30)
      • conflict (34)
      • conflict (42)
      • conflict (47)
      • conflict (52-53)
      • insertion (55)
      • conflict (57-58)
      • conflict (68)
      • conflict (70)
      • conflict (79-80)
      • conflict (86)
      • insertion (98)
      • conflict (99)
      • conflict (101-103)
      • conflict (106-108)
      • conflict (115)
      • conflict (120)
      • insertion (195)
    Domains in SCOP 1.75: d1iaii1, d1iaii2
  • Chain 'L':
    Compound: idiotypic fab 730.1.4 (igg1) of virus neutralizing antibody
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • GB AAG12167 (0-213)
      • conflict (7)
      • conflict (20)
      • conflict (27)
      • conflict (29)
      • conflict (31)
      • conflict (45)
      • conflict (53)
      • conflict (55)
      • conflict (67)
      • conflict (72)
      • conflict (75-76)
      • conflict (79)
      • conflict (84)
      • conflict (86)
      • conflict (88)
      • conflict (90-91)
      • conflict (93)
      • conflict (95)
      • conflict (99)
      • conflict (105)
    Domains in SCOP 1.75: d1iail1, d1iail2
  • Chain 'M':
    Compound: anti-idiotypic fab 409.5.3 (igg2a)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • GB AAB34980 (1-214)
      • conflict (2)
      • conflict (9)
      • conflict (11)
      • conflict (17)
      • conflict (20)
      • conflict (24-25)
      • insertion (27-28)
      • conflict (30)
      • conflict (32-33)
      • conflict (41)
      • conflict (46)
      • conflict (50)
      • conflict (53)
      • conflict (60)
      • conflict (92)
      • conflict (94)
      • conflict (113)
    Domains in SCOP 1.75: d1iaim1, d1iaim2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iaiH (H:)
    qiqlvqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmawintytgepty
    addfkgrfafsletsastaylqinnlknedtatyfcardgyyenyyamdywgqgtsvtvs
    sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
    dlytlsssvtvtssttpsqsitcnvahpasstkvdkkid
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iaiI (I:)
    evklqesggglvqpggsmklscvasgftfnnywmswvrqspekglewvaeirlnsdnfat
    hyaesvkgkfiisrddsksrlylqmnslraedtgiyycvlrplfyyavdywgqgtsvtvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpstwrpsetvtcnvahpasstkvdkki
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iaiL (L:)
    divmtqshkfmstsvgdrvsitckasqdvstavawyqqkpgqspklliysasyqytgvpd
    rftgsgsrtdftftinsvqaedlavyychqhystpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iaiM (M:)
    diqltqspafmaaspgekvtitcsvsssisssnlhwyqqksetspkpwiygtsnlasgvp
    vrfsgsgsgtsysltissmeaedaatyycqqwnsypytfgggtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec