PDB entry 1iag

View 1iag on RCSB PDB site
Description: first structure of a snake venom metalloproteinase: a prototype for matrix metalloproteinases(slash)collagenases
Deposited on 1994-05-09, released 1994-08-31
The last revision prior to the SCOP 1.69 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 2 Å
R-factor: 0.172
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1iag__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1iag_ (-)
    enlpqryielvvvadrrvfmkynsdlniirtrvheivniinkfyrslnirvsltdleiws
    gqdfitiqssssntlnsfgewrervlliwkrhdnaqlltainfegkiigkaytssmcnpr
    ssvgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsd
    dsmgyyqkflnqykpqcilnkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iag_ (-)
    nlpqryielvvvadrrvfmkynsdlniirtrvheivniinkfyrslnirvsltdleiwsg
    qdfitiqssssntlnsfgewrervlliwkrhdnaqlltainfegkiigkaytssmcnprs
    svgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsdd
    smgyyqkflnqykpqcilnkp