PDB entry 1iac

View 1iac on RCSB PDB site
Description: refined 1.8 angstroms x-ray crystal structure of astacin, a zinc-endopeptidase from the crayfish astacus astacus l. structure determination, refinement, molecular structure and comparison with thermolysin
Class: zinc endopeptidase
Keywords: zinc endopeptidase
Deposited on 1994-05-09, released 1994-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.16
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: astacin
  Species: Astacus astacus [TaxId:6715]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07584 (0-199)
  Domains in SCOPe 2.08: d1iaca_
• Heterogens: HG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iacA (A:)
  aailgdeylwsggvipytfagvsgadqsailsgmqeleektcirfvprttesdyveifts
  gsgcwsyvgrisgaqqvslqangcvyhgtiihelmhaigfyhehtrmdrdnyvtinyqnv
  dpsmtsnfdidtysryvgedyqyysimhygkysfsiqwgvletivplqngidltdpydka
  hmlqtdanqinnlytnecsl