PDB entry 1ia9

View 1ia9 on RCSB PDB site
Description: crystal structure of the atypical protein kinase domain of a trp ca-channel, chak (amppnp complex)
Deposited on 2001-03-22, released 2001-06-06
The last revision prior to the SCOP 1.63 freeze date was dated 2001-06-06, with a file datestamp of 2001-06-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.24
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1ia9a_
  • Chain 'B':
    Domains in SCOP 1.63: d1ia9b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ia9A (A:)
    yyysavernnlmrlsqsipfvpvpprgepvtvyrleesspsilnnsmsswsqlglcakie
    flskeemggglrravkvlctwsehdilksghlyiiksflpevintwssiykedtvlhlcl
    reiqqqraaqkltfafnqmkpksipysprflevfllychsagqwfaveecmtgefrkynn
    nngdeiiptntleeimlafshwtyeytrgellvldlqgvgenltdpsvikaeekrscdmv
    fgpanlgedaiknfrakhhcnsccrklklpdlkrndyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ia9A (A:)
    yyysavernnlmrlsqsipfvpvpprgepvtvyrleesspsilnnsmsswsqlglcakie
    flskmggglrravkvlctwsehdilksghlyiiksflpevintwssiykedtvlhlclre
    iqqqraaqkltfafnqmkpksipysprflevfllychsagqwfaveecmtgefrkynnnn
    gdeiiptntleeimlafshwtyeytrgellvldlqgvgenltdpsvikaeekrscdmvfg
    panlgedaiknfrakhhcnsccrklklpdlkrndyt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ia9B (B:)
    tnyyysavernnlmrlsqsipfvpvpprgepvtvyrleesspsilnnsmsswsqlglcak
    ieflskeemggglrravkvlctwsehdilksghlyiiksflpevintwssiykedtvlhl
    clreiqqqraaqkltfafnqmkpksipysprflevfllychsagqwfaveecmtgefrky
    nnnngdeiiptntleeimlafshwtyeytrgellvldlqgvgenltdpsvikaeekrscd
    mvfgpanlgedaiknfrakhhcnsccrklklpdlkrndyt