PDB entry 1ia7

View 1ia7 on RCSB PDB site
Description: crystal structure of the cellulase cel9m of c. cellulolyticium in complex with cellobiose
Class: hydrolase
Keywords: Cellulase, alpha barrel, HYDROLASE
Deposited on 2001-03-22, released 2002-10-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.168
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase cel9m
    Species: Clostridium cellulolyticum [TaxId:1521]
    Database cross-references and differences (RAF-indexed):
    • GB AAG45160 (0-End)
      • see remark 999 (281)
    Domains in SCOPe 2.06: d1ia7a_
  • Heterogens: CA, ZN, NI, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ia7A (A:)
    agthdystalkdsiiffdankcgpqagennvfdwrgachttdgsdvgvdltggyhdagdh
    vkfglpqgysaailgwslyefkesfdatgnttkmlqqlkyftdyflkshpnsttfyyqvg
    egnadhtywgapeeqtgqrpslykadpsspasdilsetsaaltlmylnyknidsayatkc
    lnaakelyamgkanqgvgngqsfyqatsfgddlawaatwlytatndstyitdaeqfitlg
    ntmnenkmqdkwtmcwddmyvpaalrlaqitgkqiykdaiefnfnywktqvtttpgglkw
    lsnwgvlryaaaesmvmlvyckqnpdqslldlakkqvdyilgdnpanmsyiigygsnwci
    hphhraangytyangdnakpakhlltgalvggpdqndkflddanqyqytevaldynaglv
    gvlagaikffggtivnppvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ia7A (A:)
    agthdystalkdsiiffdankcgpqagennvfdwrgachttdgsdvgvdltggyhdagdh
    vkfglpqgysaailgwslyefkesfdatgnttkmlqqlkyftdyflkshpnsttfyyqvg
    egnadhtywgapeeqtgqrpslykadpsspasdilsetsaaltlmylnyknidsayatkc
    lnaakelyamgkanqgvgngqsfyqatsfgddlawaatwlytatndstyitdaeqfitlg
    ntmnenkmqdkwtmcwddmyvpaalrlaqitgkqiykdaiefnfnywktqvtttpgglkw
    lsnwgvlryaaaesmvmlvyckqnpdqslldlakkqvdyilgdnpanmsyiigygsnwci
    hphhraangytyangdnakpakhlltgalvggpdqndkflddanqyqytevaldynaglv
    gvlagaikffg