PDB entry 1ia6

View 1ia6 on RCSB PDB site
Description: crystal structure of the cellulase cel9m of c. cellulolyticum
Deposited on 2001-03-22, released 2002-10-30
The last revision prior to the SCOP 1.65 freeze date was dated 2002-10-30, with a file datestamp of 2002-10-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.158
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ia6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ia6A (A:)
    agthdystalkdsiiffdankcgpqagennvfdwrgachttdgsdvgvdltggyhdagdh
    vkfglpqgysaailgwslyefkesfdatgnttkmlqqlkyftdyflkshpnsttfyyqvg
    egnadhtywgapeeqtgqrpslykadpsspasdilsetsaaltlmylnyknidsayatkc
    lnaakelyamgkanqgvgngqsfyqatsfgddlawaatwlytatndstyitdaeqfitlg
    ntmnenkmqdkwtmcwddmyvpaalrlaqitgkqiykdaiefnfnywktqvtttpgglkw
    lsnwgvlryaaaesmvmlvyckqnpdqslldlakkqvdyilgdnpanmsyiigygsnwci
    hphhraangytyangdnakpakhlltgalvggpdqndkflddanqyqytevaldynaglv
    gvlagaikffggtivnppvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ia6A (A:)
    agthdystalkdsiiffdankcgpqagennvfdwrgachttdgsdvgvdltggyhdagdh
    vkfglpqgysaailgwslyefkesfdatgnttkmlqqlkyftdyflkshpnsttfyyqvg
    egnadhtywgapeeqtgqrpslykadpsspasdilsetsaaltlmylnyknidsayatkc
    lnaakelyamgkanqgvgngqsfyqatsfgddlawaatwlytatndstyitdaeqfitln
    kmqdkwtmcwddmyvpaalrlaqitgkqiykdaiefnfnywktqvtttpgglkwlsnwgv
    lryaaaesmvmlvyckqnpdqslldlakkqvdyilgdnpanmsyiigygsnwcihphhra
    angytyadnakpakhlltgalvggpdqndkflddanqyqytevaldynaglvgvlagaik
    ffg