PDB entry 1ia5

View 1ia5 on RCSB PDB site
Description: polygalacturonase from aspergillus aculeatus
Class: hydrolase
Keywords: polygalacturonase, glycosylhydrolase, hydrolase
Deposited on 2001-03-22, released 2001-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polygalacturonase
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • GB AAC23565 (0-338)
    Domains in SCOPe 2.07: d1ia5a_
  • Heterogens: MAN, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ia5A (A:)
    attctfsgsngassasksktscstivlsnvavpsgttldltklndgthvifsgettfgyk
    ewsgplisvsgsdltitgasghsingdgsrwwdgeggnggktkpkffaahsltnsvisgl
    kivnspvqvfsvagsdyltlkditidnsdgddngghntdafdigtstyvtisgatvynqd
    dcvavnsgeniyfsggycsgghglsigsvggrsdntvknvtfvdstiinsdngvriktni
    dttgsvsdvtykditltsiakygivvqqnygdtsstpttgvpitdfvldnvhgsvvssgt
    niliscgsgscsdwtwtdvsvsggktsskctnvpsgasc