PDB entry 1i9z

View 1i9z on RCSB PDB site
Description: crystal structure of inositol polyphosphate 5-phosphatase domain (ipp5c) of spsynaptojanin in complex with inositol (1,4)-bisphosphate and calcium ion
Class: hydrolase
Keywords: SpSynaptojanin, IPP5C, IP3, IP2,, HYDROLASE
Deposited on 2001-03-21, released 2001-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.191
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol phosphate phosphatase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i9za_
  • Heterogens: CA, 2IP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i9zA (A:)
    ydpiheyvnhelrkrenefsehknvkifvasynlngcsattklenwlfpentpladiyvv
    gfqeivqltpqqvisadpakrrewescvkrllngkctsgpgyvqlrsgqlvgtalmifck
    esclpsiknvegtvkktglggvsgnkgavairfdyedtglcfitshlaagytnyderdhd
    yrtiasglrfrrgrsifnhdyvvwfgdfnyrisltyeevvpciaqgklsylfeydqlnkq
    mltgkvfpffselpitfpptykfdigtdiydtsdkhrvpawtdrilyrgelvphsyqsvp
    lyysdhrpiyatyeanivkvdrekkkilfeelynqrkqevrdasqts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9zA (A:)
    ydpiheyvnhelrkrenefsehknvkifvasynlngcsattklenwlfpentpladiyvv
    gfqeivqltsadpakrrewescvkrllngkctsgpgyvqlrsgqlvgtalmifckesclp
    siknvegtvkktglgnkgavairfdyedtglcfitshlaagytnyderdhdyrtiasglr
    frrgrsifnhdyvvwfgdfnyrisltyeevvpciaqgklsylfeydqlnkqmltgkvfpf
    fselpitfpptykfdigtdiydtsdkhrvpawtdrilyrgelvphsyqsvplyysdhrpi
    yatyeanivkvdrekkkilfeelynqrkqevrdasq