PDB entry 1i9y

View 1i9y on RCSB PDB site
Description: crystal structure of inositol polyphosphate 5-phosphatase domain (ipp5c) of spsynaptojanin
Class: hydrolase
Keywords: IPP5C, inositol 5-phosphatase,, HYDROLASE
Deposited on 2001-03-21, released 2001-05-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol phosphate phosphatase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1i9ya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i9yA (A:)
    ydpiheyvnhelrkrenefsehknvkifvasynlngcsattklenwlfpentpladiyvv
    gfqeivqltpqqvisadpakrrewescvkrllngkctsgpgyvqlrsgqlvgtalmifck
    esclpsiknvegtvkktglggvsgnkgavairfdyedtglcfitshlaagytnyderdhd
    yrtiasglrfrrgrsifnhdyvvwfgdfnyrisltyeevvpciaqgklsylfeydqlnkq
    mltgkvfpffselpitfpptykfdigtdiydtsdkhrvpawtdrilyrgelvphsyqsvp
    lyysdhrpiyatyeanivkvdrekkkilfeelynqrkqevrdasqts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9yA (A:)
    ydpiheyvnhelrkrenefsehknvkifvasynlngcsattklenwlfpentpladiyvv
    gfqeivqltsadpakrrewescvkrllngkctsgpgyvqlrsgqlvgtalmifckesclp
    siknvegtvkktglgnkgavairfdyedtglcfitshlaagytnyderdhdyrtiasglr
    frrgrsifnhdyvvwfgdfnyrisltyeevvpciaqgklsylfeydqlnkqmltgkvfpf
    fselpitfpptykfdigtdiydtsdkhrvpawtdrilyrgelvphsyqsvplyysdhrpi
    yatyeanivkvdrekkkilfeelynqrkqevrdasq