PDB entry 1i9t

View 1i9t on RCSB PDB site
Description: crystal structure of the oxidized rna triphosphatase domain of mouse mrna capping enzyme
Deposited on 2001-03-20, released 2001-05-23
The last revision prior to the SCOP 1.63 freeze date was dated 2001-05-23, with a file datestamp of 2001-05-23.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1i9ta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i9tA (A:)
kipprwlncprrgqpvagrflplktmlgprydsqvaeenrfhpsmlsnylkslkvkmsll
vdltntsrfydrndiekegikyiklqckghgecpttentetfirlcerfnersppeligv
hcthgfnrtgflicaflvekmdwsieaavatfaqarppgiykgdylkelfrrygdieeap
pppvlpdwcf