PDB entry 1i9s

View 1i9s on RCSB PDB site
Description: crystal structure of the rna triphosphatase domain of mouse mrna capping enzyme
Deposited on 2001-03-20, released 2001-05-23
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-23, with a file datestamp of 2001-05-23.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.196
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1i9sa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i9sA (A:)
    kipprwlncprrgqpvagrflplktmlgprydsqvaeenrfhpsmlsnylkslkvkmsll
    vdltntsrfydrndiekegikyiklqckghgecpttentetfirlcerfnersppeligv
    hcthgfnrtgflicaflvekmdwsieaavatfaqarppgiykgdylkelfrrygdieeap
    pppvlpdwcfeded
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9sA (A:)
    kipprwlncprrgqpvagrflplktmlgprydsqvaeenrfhpsmlsnylkslkvkmsll
    vdltntsrfydrndiekegikyiklqckghgecpttentetfirlcerfpeligvhcthg
    fnrtgflicaflvekmdwsieaavatfaqarppgiykgdylkelfrrygdieeappppvl
    pdwcfeded