PDB entry 1i9s

View 1i9s on RCSB PDB site
Description: crystal structure of the RNA triphosphatase domain of mouse mRNA capping enzyme
Class: hydrolase
Keywords: RNA triphosphatase domain, mRNA capping enzyme, HYDROLASE
Deposited on 2001-03-20, released 2001-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.196
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRNA capping enzyme
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i9sa_
  • Heterogens: SO4, CAC, MG, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i9sA (A:)
    maynkipprwlncprrgqpvagrflplktmlgprydsqvaeenrfhpsmlsnylkslkvk
    msllvdltntsrfydrndiekegikyiklqckghgecpttentetfirlcerfnersppe
    ligvhcthgfnrtgflicaflvekmdwsieaavatfaqarppgiykgdylkelfrrygdi
    eeappppvlpdwcfededeedededgkkds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9sA (A:)
    kipprwlncprrgqpvagrflplktmlgprydsqvaeenrfhpsmlsnylkslkvkmsll
    vdltntsrfydrndiekegikyiklqckghgecpttentetfirlcerfpeligvhcthg
    fnrtgflicaflvekmdwsieaavatfaqarppgiykgdylkelfrrygdieeappppvl
    pdwcfeded