PDB entry 1i9r

View 1i9r on RCSB PDB site
Description: structure of cd40l in complex with the fab fragment of humanized 5c8 antibody
Class: cytokine/immune system
Keywords: beta-sheet sandwich, immunoglobulin
Deposited on 2001-03-20, released 2002-03-20
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.233
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cd40 ligand
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1i9ra_
  • Chain 'B':
    Compound: cd40 ligand
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1i9rb_
  • Chain 'C':
    Compound: cd40 ligand
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1i9rc_
  • Chain 'H':
    Compound: immunoglobulin h
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1i9rh1, d1i9rh2
  • Chain 'K':
    Compound: immunoglobulin h
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1i9rk1, d1i9rk2
  • Chain 'L':
    Compound: immunoglobulin l
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1i9rl1, d1i9rl2
  • Chain 'M':
    Compound: immunoglobulin l
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1i9rm1, d1i9rm2
  • Chain 'X':
    Compound: immunoglobulin h
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1i9rx1, d1i9rx2
  • Chain 'Y':
    Compound: immunoglobulin l
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1i9ry1, d1i9ry2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i9rA (A:)
    gdqnpqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqv
    tfcsnreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpga
    svfvnvtdpsqvshgtgftsfgllkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9rA (A:)
    npqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfc
    snreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvf
    vnvtdpsqvshgtgftsfgllkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i9rB (B:)
    gdqnpqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqv
    tfcsnreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpga
    svfvnvtdpsqvshgtgftsfgllkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9rB (B:)
    npqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfc
    snreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvf
    vnvtdpsqvshgtgftsfgllkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1i9rC (C:)
    gdqnpqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqv
    tfcsnreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpga
    svfvnvtdpsqvshgtgftsfgllkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9rC (C:)
    npqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfc
    snreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvf
    vnvtdpsqvshgtgftsfgllkl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9rH (H:)
    qvqlvqsgaevvkpgasvklsckasgyiftsyymywvkqapgqglewigeinpsngdtnf
    nekfkskatltvdksastaymelsslrsedtavyyctrsdgrndmdswgqgtlvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9rK (K:)
    qvqlvqsgaevvkpgasvklsckasgyiftsyymywvkqapgqglewigeinpsngdtnf
    nekfkskatltvdksastaymelsslrsedtavyyctrsdgrndmdswgqgtlvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1i9rL (L:)
    divltqspatlsvspgeratiscrasqrvssstysymhwyqqkpgqppkllikyasnles
    gvparfsgsgsgtdftltissvepedfatyycqhsweipptfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9rL (L:)
    divltqspatlsvspgeratiscrasqrvssstysymhwyqqkpgqppkllikyasnles
    gvparfsgsgsgtdftltissvepedfatyycqhsweipptfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1i9rM (M:)
    divltqspatlsvspgeratiscrasqrvssstysymhwyqqkpgqppkllikyasnles
    gvparfsgsgsgtdftltissvepedfatyycqhsweipptfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9rM (M:)
    divltqspatlsvspgeratiscrasqrvssstysymhwyqqkpgqppkllikyasnles
    gvparfsgsgsgtdftltissvepedfatyycqhsweipptfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9rX (X:)
    qvqlvqsgaevvkpgasvklsckasgyiftsyymywvkqapgqglewigeinpsngdtnf
    nekfkskatltvdksastaymelsslrsedtavyyctrsdgrndmdswgqgtlvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1i9rY (Y:)
    divltqspatlsvspgeratiscrasqrvssstysymhwyqqkpgqppkllikyasnles
    gvparfsgsgsgtdftltissvepedfatyycqhsweipptfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9rY (Y:)
    divltqspatlsvspgeratiscrasqrvssstysymhwyqqkpgqppkllikyasnles
    gvparfsgsgsgtdftltissvepedfatyycqhsweipptfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnr