PDB entry 1i9i

View 1i9i on RCSB PDB site
Description: native crystal structure of the recombinant monoclonal wild type anti-testosterone fab fragment
Class: immune system
Keywords: fab fragment, anti-testosterone, recombinant, monoclonal, IMMUNE SYSTEM
Deposited on 2001-03-20, released 2002-03-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: 0.195
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: recombinant monoclonal anti-testosterone fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1i9ih1, d1i9ih2
  • Chain 'L':
    Compound: recombinant monoclonal anti-testosterone fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1i9il1, d1i9il2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9iH (H:)
    evklvesggglvkpggslklscaasgftfstyalswvrqtadkrlewvasivsggntyys
    gsvkgrftisrdiarnilylqmsslrsedtamyycareyygyvglaywgqgtlvtvsaak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9iL (L:)
    dvvvtqtplslpvslgdqasiscrssqsivhsngnsylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec