PDB entry 1i9i

View 1i9i on RCSB PDB site
Description: native crystal structure of the recombinant monoclonal wild type anti-testosterone fab fragment
Deposited on 2001-03-20, released 2002-03-20
The last revision prior to the SCOP 1.61 freeze date was dated 2002-03-20, with a file datestamp of 2002-03-20.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: 0.195
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9iH (H:)
    evklvesggglvkpggslklscaasgftfstyalswvrqtadkrlewvasivsggntyys
    gsvkgrftisrdiarnilylqmsslrsedtamyycareyygyvglaywgqgtlvtvsaak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9iL (L:)
    dvvvtqtplslpvslgdqasiscrssqsivhsngnsylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec