PDB entry 1i9b

View 1i9b on RCSB PDB site
Description: x-ray structure of acetylcholine binding protein (achbp)
Class: ligand binding protein
Keywords: pentamer, igg fold, LIGAND BINDING PROTEIN
Deposited on 2001-03-18, released 2001-05-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.26
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1i9ba1, d1i9ba2
  • Chain 'B':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1i9bb1, d1i9bb2
  • Chain 'C':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1i9bc1, d1i9bc2
  • Chain 'D':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1i9bd1, d1i9bd2
  • Chain 'E':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1i9be1, d1i9be2
  • Heterogens: CA, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i9bA (A:)
    eaeayvefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfw
    qqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevly
    mpsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfei
    ldvtqkknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9bA (A:)
    fdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i9bB (B:)
    eaeayvefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfw
    qqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevly
    mpsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfei
    ldvtqkknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9bB (B:)
    fdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1i9bC (C:)
    eaeayvefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfw
    qqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevly
    mpsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfei
    ldvtqkknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9bC (C:)
    fdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1i9bD (D:)
    eaeayvefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfw
    qqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevly
    mpsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfei
    ldvtqkknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9bD (D:)
    fdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1i9bE (E:)
    eaeayvefdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfw
    qqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevly
    mpsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfei
    ldvtqkknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9bE (E:)
    fdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkg