PDB entry 1i9b

View 1i9b on RCSB PDB site
Description: x-ray structure of acetylcholine binding protein (achbp)
Deposited on 2001-03-18, released 2001-05-16
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-16, with a file datestamp of 2001-05-16.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.26
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1i9ba_
  • Chain 'B':
    Domains in SCOP 1.57: d1i9bb_
  • Chain 'C':
    Domains in SCOP 1.57: d1i9bc_
  • Chain 'D':
    Domains in SCOP 1.57: d1i9bd_
  • Chain 'E':
    Domains in SCOP 1.57: d1i9be_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9bA (A:)
    fdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9bB (B:)
    fdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9bC (C:)
    fdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9bD (D:)
    fdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9bE (E:)
    fdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkg