PDB entry 1i9a

View 1i9a on RCSB PDB site
Description: structural studies of cholesterol biosynthesis: mevalonate 5-diphosphate decarboxylase and isopentenyl diphosphate isomerase
Class: isomerase
Keywords: alpha/beta protein, isomerase, Mn2+, structural genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2001-03-18, released 2001-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isopentenyl-diphosphate delta-isomerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46822
      • modified residue (136)
      • modified residue (161)
      • modified residue (163)
    Domains in SCOPe 2.08: d1i9aa_
  • Chain 'B':
    Compound: Isopentenyl-diphosphate delta-isomerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46822
      • modified residue (136)
      • modified residue (161)
      • modified residue (163)
    Domains in SCOPe 2.08: d1i9ab_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i9aA (A:)
    mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpg
    vwtnsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpv
    faarttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftq
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9aA (A:)
    ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
    nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
    rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i9aB (B:)
    mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpg
    vwtnsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpv
    faarttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftq
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9aB (B:)
    ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
    nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
    rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftql