PDB entry 1i99

View 1i99 on RCSB PDB site
Description: crystal structure of michaelis serpin-trypsin complex
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Michaelis serpin-protease complex inhibitory triad
Deposited on 2001-03-18, released 2001-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2001-11-21, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.177
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: trypsin II, anionic
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (0-222)
      • engineered (173)
    Domains in SCOPe 2.07: d1i99e_
  • Chain 'I':
    Compound: alaserpin
    Species: Manduca sexta
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14754 (Start-377)
      • conflict (271)
      • conflict (314)
      • engineered (344)
    Domains in SCOPe 2.07: d1i99i_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i99E (E:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggp
    vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1i99I (I:)
    magetdlqkilresndqftaqmfsevvkanpgqnvvlsafsvlpplgqlalasvgeshde
    llralalpndnvtkdvfadlnrgvravkgvdlkmaskiyvakglelnddfaavsrdvfgs
    evqnvdfvksveaagainkwvedqtnnriknlvdpdaldettrsvlvnaiyfkgswkdkf
    vkertmdrdfhvskdktikvptmigkkdvryadvpeldakmiemsyegdqasmiiilpnq
    vdgitaleqklkdpkalsraeerlynteveitlpkfkietttdlkevlsnmnikklftpg
    aarlenllktkesltvdaaiqkafievneegaeaaaanafgivpkslilypevhidrpfy
    felkidgipmfngkviep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i99I (I:)
    getdlqkilresndqftaqmfsevvkanpgqnvvlsafsvlpplgqlalasvgeshdell
    ralalpndnvtkdvfadlnrgvravkgvdlkmaskiyvakglelnddfaavsrdvfgsev
    qnvdfvksveaagainkwvedqtnnriknlvdpdaldettrsvlvnaiyfkgswkdkfvk
    ertmdrdfhvskdktikvptmigkkdvryadvpeldakmiemsyegdqasmiiilpnqvd
    gitaleqklkdpkalsraeerlynteveitlpkfkietttdlkevlsnmnikklftpgaa
    rlenllktkesltvdaaiqkafievneegaeaaaanafgivpkslilypevhidrpfyfe
    lkidgipmfngkviep